SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02916 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02916
Domain Number 1 Region: 3-65
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000161
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 2 Region: 506-566
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000356
Family SAM (sterile alpha motif) domain 0.0085
Further Details:      
 
Weak hits

Sequence:  281687.CJA02916
Domain Number - Region: 154-200
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02916
Sequence length 592
Comment (Caenorhabditis japonica)
Sequence
MELHHSLHSHIIGKGGRGIQKVMKMTSCHIHFPDSNKYSEANKSDQVSVSGTPVNVFEAL
KQLRTMCPLTVYMKLPWYNPGQPDLRPLMSQMDLEVNVNQNIYSLAIKMSGSQDASVLFA
IRLVLHHFLLTEEYINISTTVLAKEELIFQLENVGEQREKLREVCNKNGVTIQTFPETQS
ISIVGPPSGVLNVRKLLIGLASVTVQFDCNMMDVHYPVQQLEQERGLQIGCKRKNGDVMT
ITIKSSESKLAEILQSRELLLALPPTTYSCPDDYDPSPPMNSGFSFKVSMIIHKIVVPGP
ATLTPLQTEMANGVRVFLTPPIESPKSPDPEDSPLAASILKGAKEISKNSDIWKKKPKAD
RGEMLIKATQAIFDDSVLSSPRYPTDLWSGYGFSSSLPADLLKGMLDLSTSEVPYFLFFF
FDQVFCSICSFQPSSTATNSLFLNSQRGTGLCSVREEDEELSDFSASSTNYGMSRAQFEL
PSRNVFSASTSVFDSNSLPYDLQWDINYFTDPSMVLAQLGCSEYMTQLRDQEIDMHAFLL
LDEQNLKDIGVSTIGARKKIHHAILSQFKKKYFIKSQFSELRDSARLNGYAV
Download sequence
Identical sequences 281687.CJA02916 CJA02916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]