SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA02924 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA02924
Domain Number 1 Region: 125-239
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.74e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA02924
Sequence length 391
Comment (Caenorhabditis japonica)
Sequence
MSTSPVSSEALAESVQLLRLADKAMMTPPPSEDKAPPSSQKSTSNHSDSDPKQAAGNADN
NTYIESLKEERQQLSHHADCLNHVFTLIDKEIKRVTGNEVSKDAVLSEIIAVPVEKYPNV
RVALFRPLNTIFQYNFVGRILGPRGTTAKQLEASIGCKVTILGRTKKDVSTESLAPTDNG
PLRVQISCPADLPDAAQRMEAGISVINALLVPPADGQDELKRQQLMVLANMNGTYRPRSS
TSQSQYNTGGAGDFGHQHQFQNLLPYGYRLPVMSKSQHEMPNEFNLLHSHLSSNSISNSH
STKFDCFNPKCTILRNLIEQNSSKNATPKIEDVLNVMHMYELMNRIRLANSSLFGEPRRY
DDMVKAQEIGKRMCSALGTPAHRSRLQQAKK
Download sequence
Identical sequences CJA02924 281687.CJA02924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]