SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA03324 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA03324
Domain Number 1 Region: 146-247
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000131
Family Eukaryotic type KH-domain (KH-domain type I) 0.0079
Further Details:      
 
Weak hits

Sequence:  281687.CJA03324
Domain Number - Region: 106-160
Classification Level Classification E-value
Superfamily Gametocyte protein Pfg27 0.0523
Family Gametocyte protein Pfg27 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA03324
Sequence length 389
Comment (Caenorhabditis japonica)
Sequence
MVQMSKSEVKKPRGEYAPDWADEPEEEVKLRKETAKMFGPQKDSEWWDINTFTKEDNPNG
LLQESSFSSLFPKYREKYIKESWPLVEKALAEHQLKADLDLLEGTMCVRTTRKTWDPYII
MKAREVIKLLSRSVPYEQAIRVLEDEIYCEIIKISSMVRNKERFVKRRARLIGNDGATLK
ALELLTQCYVCVQGGTVCAVGPLAGLKQINQIVTDCMKNIHPIYNIKTMMIKRELAKNDE
LKDSNWDPYLPKYRKKVQSATTTKDAKKKKKMMQKMKPKGEYTPFPPAPVLSKIDKQIES
GEYFIREHERKLNKKRSVIFLFVSNYDSTFRAKLEASAVKTVERQQLKLKVYQAKEEAPR
EKATKKRVADAPIDLEKLKKKVKVGKGSK
Download sequence
Identical sequences 281687.CJA03324 CJA03324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]