SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA03531 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA03531
Domain Number 1 Region: 1112-1243
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-41
Family Galectin (animal S-lectin) 0.00022
Further Details:      
 
Domain Number 2 Region: 973-1117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.6e-37
Family Galectin (animal S-lectin) 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA03531
Sequence length 1244
Comment (Caenorhabditis japonica)
Sequence
MSDSSSFFSSAFSSAKNLIPFSKNSEKDVDAPAAEESKDTAIQEAVQQASAVINDVFSDA
VDKLEDVKDAVVDKLTNGDVKKEEEPVSDEVGEKFESVHVAVDGDVKEAQVVVKGVLADG
TQVVEGVVEPVAASEVAAPAQEAVPAQEEPKVEAPAAESVAEQSPHQEAAPESDTAAQLP
EGARVVFNGVLADGTHVIEAVSSNPPVQQEESAPAVAVVEEPALSEAAPEAVPASVEEHK
EEAAPSEARPSEAASESVPVPADEHKEEAASSEAAPVGIVENFIEAVNLSAPEAVPAPVE
EQKXXXXGAQESAPASVEEHKEEAASSEAVPEAVPAPVEEHKEDAVPSEAPVQEAVQEAA
APSEAAPEAVLAPAEEHKEEDPAQEAAPEAAASSEAPAQEASTPDHKEETATEATAQSEA
APVGTVENFIEAVNLSAPEAVPAPAEEHKEEAAPSDAAPEAVAAQDYAPAPVEEHHEKAA
PSAVPDQEAAAPSEAAPADIVEEAIQSVHVGAQESAPAPDEEHKEEAAPSEALAQETAPE
AVPASVEEHKEDAAQSEAVPSQDVAPEAAAPAQDAVPVGTVENFIEAVNLSAPEAVPVPA
EEQKEEGAPSEAPAQEAASEHKEEAAPEASASVDAVEETIQSVHVGAQEYAPAPVEEHHE
KAAPSEVPDQEAAPAPAEEQKEDAALSDVAPEASASVAAVEEAIQSVHVGAQEYAPSPDE
EHHEKAAPSEVPDQEAAPAPAEEQKQEAASEEAAVAYHIESVEAAAAPSQEHTPESIEDI
VHVTADDAQPDSGRSVEENAALSGGEETFEKVEHSQVAEAPTSETAAAPAVSEPEIVNDA
VEEPVVQQVVAAVAAAPVSFVFFFWVFANEQPPLLVLVSSSSSSPSFLFFFSFSLVPTSL
PLSLFLLCFQSSCKMKTRNPAHLFVRISESCFHDATSLITQYFQTKNHCVLKEAQPEAKK
PRTLAEMAHESAYPVPYRSKLVEPFEPGQTLIVKGKTGEDSIRFTVNLHSNTADFSGNDV
PLHVSVRFDEGKLVFNTFAKGEWGKEERKSNPYKKGDDIDIRIRAHDSRFQIFVDQKEVK
EYEHRVPLSSITHFTIDGDVLVNYIHWGGKYYPVPYESGLAADGLAPGKTLTVFGIPEKK
AKRFHINLLKKNGDIALHLNSRFDEKHVVRNSLINSAWGNEEREGKLPFEKAVGFDLEIH
NEPYAFSITVNGERFASYAHRLSPDEVNGLQIGGDVEITGIQIA
Download sequence
Identical sequences 281687.CJA03531 CJA03531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]