SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA03616 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA03616
Domain Number 1 Region: 56-120
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000589
Family BTB/POZ domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA03616
Sequence length 185
Comment (Caenorhabditis japonica)
Sequence
MLINTSSTADSTTIIDLENQYYYVNPRHAKSEFDIDGFKCESQFDGLNFSRPFDESNAVL
RVEDEEFHVHSFLLSMASQFFRILFNGSFAESANISKPIELKGISSCSFRNLLNCIYGYP
SVFRITRGLNKLLLCFPSTCDMKTRFISSLHSPFCLRLFKYHSVRVVVRQLLRQEPHLVG
LVSCL
Download sequence
Identical sequences CJA03616 281687.CJA03616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]