SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04061 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA04061
Domain Number 1 Region: 19-109
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.13e-25
Family Calponin-homology domain, CH-domain 0.00042
Further Details:      
 
Domain Number 2 Region: 542-640
Classification Level Classification E-value
Superfamily E set domains 1.07e-23
Family Filamin repeat (rod domain) 0.00093
Further Details:      
 
Domain Number 3 Region: 757-842
Classification Level Classification E-value
Superfamily E set domains 5.48e-18
Family Filamin repeat (rod domain) 0.00063
Further Details:      
 
Domain Number 4 Region: 318-401
Classification Level Classification E-value
Superfamily E set domains 4.07e-16
Family Filamin repeat (rod domain) 0.00082
Further Details:      
 
Domain Number 5 Region: 432-509
Classification Level Classification E-value
Superfamily E set domains 0.000000000000227
Family Filamin repeat (rod domain) 0.0047
Further Details:      
 
Domain Number 6 Region: 145-232
Classification Level Classification E-value
Superfamily E set domains 0.000000876
Family Filamin repeat (rod domain) 0.043
Further Details:      
 
Weak hits

Sequence:  281687.CJA04061
Domain Number - Region: 224-310
Classification Level Classification E-value
Superfamily E set domains 0.000327
Family Filamin repeat (rod domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04061
Sequence length 849
Comment (Caenorhabditis japonica)
Sequence
MAQPPKRLDQEEEVVPAIRHEDAEWKIIQQNTFTRWVNNHLQKAGANIGSLETDLSDGLR
LIALAQVLSHKTVGKFNKKVNFRSQKLENVSLALNFFQNEENIKIINIGESFCFGYIIEF
SIEDEAILQVHPIARLLEYKKVAKVGDDVKFTIVDALEGPVEAIVVDGTGKEHRMVILEG
AAPGEHHFEYQIPNVGLHSVNVFHKKLPLAGSPFPLRGKPRNAFKVYGRGLQPLGIRKND
IVGIHVEALDPEENVANANISLEVTKPNGDRLPVSVGFDEQDQILNFEYKPTEAPEELEV
VVKVAGEVIESQKVEISPPTASKIRAFGPGLEAGIVDEPCVFAVEMNGESPNLSFAVEGP
SKTEIGCQERADGSAILSYTPTVAGVYKVGVLADGEHIQSFLFYFSLRFAVFLMFARPNR
IGFSQIYHFSAIVTVNVEKEIHVFTTDGENTRIVITSPSGRVVEAIIESTPTGFRVRFTP
SEVGNYTIDVTYQDIPIEKSPFTMQSIDPNGMSNFDQYPSSSGAVAAAPGDPGESTLAEA
EYVVFGSGPPCADLVTVSGPGLGPLVSQRSTYVLIDTTNAGFGDIDVYVDGPTKTPLHCV
DNQDGVLKMCFTPKTPGLYYLRVMFDNEHVPGSPFQIVAVAALLGSGSGLEQRSKTESPF
SSISSGSSPAPPTATQAQQAYNVLVGSRFRPKIDIGKLEPKTKGLQLLDELNGKLYNIPL
KINADGTYSTDTPLLQPGKHDLKVILLFDELPVKEATVEVKKGTDVSKCRASGPGLEEAV
VGEQAKFELDLDGAGEGAVSMEMRGPAKTESRIQDHGNGKCSVEYVANVPGEYEMVIKFG
KDDQKEHVK
Download sequence
Identical sequences 281687.CJA04061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]