SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA04683 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA04683
Domain Number 1 Region: 171-260
Classification Level Classification E-value
Superfamily POZ domain 0.00000000018
Family BTB/POZ domain 0.015
Further Details:      
 
Weak hits

Sequence:  281687.CJA04683
Domain Number - Region: 81-154
Classification Level Classification E-value
Superfamily TRAF domain-like 0.00203
Family MATH domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA04683
Sequence length 270
Comment (Caenorhabditis japonica)
Sequence
MAFEFRAKSCTPRGLLFFFQFFFISGSLLVILVILVIVVSGSQYPGWKLRSNLTSITSIR
ILGAYSEASDRTNNVKHNRSNLWSCNVSIRFSLVKLNFNDKNAAFSMEFEQKFDVNTKFF
EVPNFKNWEEANCYDNRFIIDKKAAVEALITVKNFAGIHERILETFEKPRENLTDAMLIV
EGEKVQVGKQVRIPLFLSETVKFSLQILAMSSKFFHTLFYSTFSESSQKEITIEDVKHSE
FVDFLNFVYPTHKCINSKYILSRFFSLFRK
Download sequence
Identical sequences 281687.CJA04683 CJA04683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]