SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA05350 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA05350
Domain Number 1 Region: 15-158
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.93e-42
Family Galectin (animal S-lectin) 0.00019
Further Details:      
 
Domain Number 2 Region: 154-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.9e-41
Family Galectin (animal S-lectin) 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA05350
Sequence length 287
Comment (Caenorhabditis japonica)
Sequence
MSTTPAIIRWYEQEKPVPYRSVLQEKFEPGQTLIVKGSTIDESQRFTINLHSKTADFSGN
DVPLHISIRFDEGKIVLNSFSNGEWGKEERKSNPIKKGDSFDIRVRAHDDRFQIIVDHKE
FKDYEHRLPLSSISHLSIDGDLYLNHVHWGGKYYPVPYESGLANGLPVGKTLLVFGTVEK
KAKRFHLNLLRKNGDISLHFNPRFDEKVSHVIRNSLAANEWGNEEREGKIPFEKGVGFDL
AIQNEEYAFQVFVNGERFASFAHRADPHDIAGLQISGDIELSGIQIQ
Download sequence
Identical sequences 281687.CJA05350 CJA05350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]