SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA07377 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA07377
Domain Number 1 Region: 241-319
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.97e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0005
Further Details:      
 
Domain Number 2 Region: 134-212
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000424
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 3 Region: 325-402
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000482
Family Eukaryotic type KH-domain (KH-domain type I) 0.00097
Further Details:      
 
Domain Number 4 Region: 407-451
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000872
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA07377
Sequence length 706
Comment (Caenorhabditis japonica)
Sequence
MSALYVLYNTIISPPQSTSSPIHIAPSHLYGYLILSAMSYMDQQVSSPVPSRKIKEEEEE
EEEDDRKHRSPSRERSNSPAQQQLSDRFSLEPKKETSEPELSIKRERSPEGSDEYEDVEP
PSKRPAETRVHVYPMEPNVLATVKVVFPIPENCVGLVIGRNGTEIQQISSKSNCRVQVDP
ERSTTGFRMVEIEGFGEHIEAAKALISEVVAKGNIRAAAAAGVPMSSLPSHLQEFLQKNQ
QEKITIDIPIPANKCGSVIGKGGETMRKLRSWSNCQIQLIQESNIADMDKPLRVTGDVKS
VEKAKKLVAEILESTDEQPAAFFMAGNGGSTMSLQVKVPRASVGAIMGLQGKNIRKISEE
TGTKIQFLPDDDPKLMERSLAIIGTHNKVMVAAEMIRSVVESTKFESKGPVSLFYMSIPA
SKCGLVIGRGGETIKQINTESGAHCELSREPKNICYTWRGFASGACKTSDLPKSWRHSTK
HSIWQQMVPAPQPQAPMVPHMSAQPMYPQQQAPPHQMAPIPEWQQPQRQPQPVQQYAQPT
INAMPVAQHLYQHQQIQMQQQAAPQLAGQPVPAGLSQYAQQFGQVQHQPQAQIVQNVQPA
YNPQQPQQQQQQPVAVNAGLENPKDGEQDFSAQWLEYYISIGDTEGANGVRARIAKIQEE
KARQMTAAAAPSRPVNSDNDLLYQMQRAQQQQQQQQQQQQQTQPHY
Download sequence
Identical sequences 281687.CJA07377 CJA07377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]