SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA07896 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA07896
Domain Number 1 Region: 125-255
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000038
Family MAM domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA07896
Sequence length 966
Comment (Caenorhabditis japonica)
Sequence
MKRKRLWSPAAILILIFHVAHTLLPSEEFDLDRYYAQRYVVEESVNRSTFYTVSQSFLAV
NEVPCDQLDENYCEYRKYHGKPWKTFEYRHDTCECNLDACEEQNDTLAATVLYPGCFCDR
PKGAIQCDFRAACPQWEQTSNHENLTFGFFESRKFGSFLQAGSANDVFHKRTVSLISSVF
RQSGLDCTLSFMRHFTQQSSSSKLAVRVHLESGQVQTLYEYSRGSPKAFSWIHVSVKMGS
YSQPFRISIDCETGSSPKRKKQKSKEPWDDNDRTRPPFACGLANIQFDNCHSFQLCRKCA
SRYFVGKLRRDGEDERKKRRDGEDENIRDPLGKCSRGNQFLCSTDKNTRCLNDAQCDMKE
DCEDGSDEMGCDDHKVLGSQCNFNNGRFCEGWEQVTRISDPMESQFEPTTKAPINAIGET
PIWLLRIKSPSSRFAIQKEARKGAGSFLVYQSEEARKLSRRTSALVSSAFPRTNPIAYDK
NSKYFETCKLRFYVCAKTYATTWHISIISKVKYPLDSGRISLYESRAFELSQLIQSPVCE
WERILVKVPRQNGKFKLGIFVEHRYDRDDFFAIDDLSFSPSCFEKDVNESTWQIPNLLIS
TCGTTGFERPANCDQYRALDGQTDHFLKEDGTQEWTVPNTGFYLIEACGAAGGSIDKKDG
DKGECLTLQVHLIENLALRMLIGHMGESPCITEQDDELRPASCAATSHPMRSRDAGAGGG
GATLITVEANLWNVVVGGGAGASWGNDDIFGGYGASVIPVDIDGYCKRVCRSISHTDFQV
DKNEHQCPDQKKNQSTVLGGFGGGGNTCGMIGGSGAGYLAGNPFGIGRERSGSSNVTANF
SKEVEYYQAKKVGDGFIKISKNAKNMNEGSATVQFSGFCRKQCSPPSVCRFRKDEEYCGC
PDGTEFTNSTDSCSCPLHCPSGASCQYRNFTSEPFCMCNNGKHIDDFDVDFCALRRIMGI
GKLVVV
Download sequence
Identical sequences CJA07896 281687.CJA07896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]