SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA08056 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA08056
Domain Number 1 Region: 76-223
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.74e-17
Family Galectin (animal S-lectin) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA08056
Sequence length 314
Comment (Caenorhabditis japonica)
Sequence
MLLKLFLASVTVLLATADDTAVLNCDTLTGDLRWKMIRFSRAMEVGDRLTVTGTVYSSAN
IFFKTIIVKTLLNGHPYLNAISNRMPPKTLLRTIECHGHITEFLRYMSYLHLYQGFQNQY
EDGIVSLHIRAQYERNSIIYNSFLDRTNWGREEFGPLPYRKATKYTITVVKQLNKYDVYN
GNTLIKTFAIRHPLDWQIGNLLIYGDWSAEAVSMLCVRAAEPTTAAPTTEKGKNPISDDE
GSLSGGDIVHDNGSATTKKSGNSYSGNGNSGNNHSGNYNNGHRKPNRDTSEDCDSESSNS
FQVSYEDEDCDCDE
Download sequence
Identical sequences CJA08056 281687.CJA08056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]