SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA08057 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA08057
Domain Number 1 Region: 6-105
Classification Level Classification E-value
Superfamily POZ domain 2.16e-25
Family Tetramerization domain of potassium channels 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA08057
Sequence length 141
Comment (Caenorhabditis japonica)
Sequence
MTSSEDVITLNVGGSVYTTTRNTLSKDADTLLANIASGSLGDDEQISVVTMPDGSLFVDR
DGPLFAYILHFLRTDKLSLPDQFREVARLKDEADFYRLERLSSLLAATTVISRPRTANGY
TTFGAETASSPSVLLLEVRFN
Download sequence
Identical sequences 281687.CJA08057 CJA08057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]