SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA08346 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA08346
Domain Number 1 Region: 24-271
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.53e-87
Family Calponin-homology domain, CH-domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 316-439
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-32
Family Spectrin repeat 0.00000563
Further Details:      
 
Domain Number 3 Region: 554-675
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-23
Family Spectrin repeat 0.000026
Further Details:      
 
Domain Number 4 Region: 440-549
Classification Level Classification E-value
Superfamily Spectrin repeat 3.66e-23
Family Spectrin repeat 0.0000108
Further Details:      
 
Domain Number 5 Region: 710-821
Classification Level Classification E-value
Superfamily Spectrin repeat 3.45e-17
Family Spectrin repeat 0.0000343
Further Details:      
 
Domain Number 6 Region: 813-934
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000165
Family Calmodulin-like 0.0038
Further Details:      
 
Weak hits

Sequence:  281687.CJA08346
Domain Number - Region: 276-402
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0157
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA08346
Sequence length 971
Comment (Caenorhabditis japonica)
Sequence
MVDYYQQPPSYHQPGYDYTQQEEEWDREGLLDPAWEKQQKKTFTAWCNSHLRKAGTSIDA
IEEDFRNGLKLMLLLEVISGEPLPKPDRGKMRFHKIANVNKALEYIESKGVKLVSIGAEE
IVDGNVKMTLGLIWTIILRFAIQDINVEGIIRAKLFCPICSFFSELSARDGLLLWCQRKT
APYNNVNVQNFHNSWKDGLAFCALIHRHRPDLLDYSQLHKGDPIHNLNLAFDIAEKHLDI
PKMLDAEDVARHPDEKSTMTYVSCFYHAFRNMREPPPPVIRQPPPQRVVVAPPPPPPERD
WRKDAETAANRICRVLKVNQENEKMMEDYENLASDLLAWINRWMPWLANRSTDDTLPQAQ
QKLEDYRNYRRHEKPPRIEDKGRLETLFNTLQTRLRLSNRPAFLPRDGHLIKDINAAWAG
LEDSEKGFEEWLLSEIMRLERLEHLAEKFRRKCALHEEWAHGKEDALRSNDWRSCGLYKI
KALRKRHEAFESDLGAHQDRVEQIAAIARELNNLRYPDIGPINARCQAICNQWDRLGQLS
SKRRETLEDAERIAERLDSLYLDFAKRAAPFNNWLDGAREDLADLVIVHEMREIEELVSS
HDQFKSTLGDADREFSSINQIEQEVEHLVTSHGLDRELLRNPYTDLSASDIRRKWGEVQS
SVPRRDSQLQAELKRQQSEFKKKFLHEVGFEPTHPYEYQNTQKTSNFTDNERLRTIFAEK
ANQVGPWLERELEQVLAIGLGGRGRLEDAIQQLRAIQRNVLGYKSNLDELERIHQEMQEN
FVFENRKSRYSMESLRVGWETLLTSINKTINEFENQVLLRDSKGISEDQISEFRASFSHF
DKDRAGLDPEQLRACLISVGYTIRPGREGDAELHRVLAHVDPNRMGRVPFEAFLDFMTKE
NSDQDTVEQMIDSFRILASGKVPFITADELERELPRDQAAYCMARMAPSREPGAPPRSFD
YVTFSRTLYSQ
Download sequence
Identical sequences 281687.CJA08346 CJA08346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]