SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA09240 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA09240
Domain Number 1 Region: 264-418,471-513
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-38
Family SPRY domain 0.0074
Further Details:      
 
Domain Number 2 Region: 19-85
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000422
Family PHD domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA09240
Sequence length 564
Comment (Caenorhabditis japonica)
Sequence
MRSSKGGRGRTAAPKTAPTTVCYCDGKRELGSVEIVCYQCLKWFHGRCLKEYHDLNSNGV
PFMICYAFTCKQCRPVSEDWKAKKADLVQMCVTVFATISAGKLKETGKLSAEIIPEDHTF
LSLKDTVIPYMDENWTMLTSIKKKNQWHQNLAQTLLKERNVFLQSSEDEDLFALAEKNLA
TVGPLHEAVKQIGKRPVVEREFRDPRQIELPPIEGPKTRGASKRRHAEGATAPGKKQKLA
ADYSSTATPTGAQIDIPFSKDSYRYFLTETDPNVPEDTTWNQTHANTAYVIPPFQHRVLL
NQNVIVSSNDRAFQLTVANYSVTGFEGYAMARASHGVSKGTWYFEVYFDDQPDDSHVRIG
WSQVHAPLQACVGYNKFSYGWRSKHGTKFHDAKGKKYHFGGFKQGDTLGCLIHLPVDKKT
LVPRNLPSESYLPPSYKNSTLINFKSNLFFEVHEEAADLAKELKEVAGSFIEFFHNGKSC
GKAYEDIYGGTYFPTVSIFKKATVTMNFGPKFKSLPRGATGIHMRADEQQYEQTLSDVLY
LLSKEGLNLLGSDVKQEIKLENSQ
Download sequence
Identical sequences 281687.CJA09240 CJA09240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]