SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA09698 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA09698
Domain Number 1 Region: 2-84
Classification Level Classification E-value
Superfamily POZ domain 9.42e-21
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA09698
Sequence length 150
Comment (Caenorhabditis japonica)
Sequence
MNVNKGFLSFHSPFFHALFSSNFKENSMNEIPIVDVGYKEFAELLSSIYPNAIPPTSENV
VNLMKLADRFQMEAVTNICESIVLHHPRINFVKKLAIADKYNLESLMEFCIKMFETAPDP
LKMLRDPEIKNMTPGLKSKLFDKFLEITRE
Download sequence
Identical sequences CJA09698 281687.CJA09698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]