SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA09705 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA09705
Domain Number 1 Region: 93-168
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 1.16e-32
Family Skp1 dimerisation domain-like 0.0000142
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily POZ domain 2.83e-20
Family BTB/POZ domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA09705
Sequence length 170
Comment (Caenorhabditis japonica)
Sequence
MTDAKNERQIKISSSDNEIILVPRNVIRLSTTINTLLQDLGLDDDEATNAEPIPVQNVAA
PILRKVISWCQYHYQDPVPTDDSDSREKRTDDISSWDTEFLKVDQGTLFELILAANYLDI
KGLLDVTCKAVANMIKGKSPEEIRRTFNIKNDFTPEEEEQIRKENAWCED
Download sequence
Identical sequences A0A2H2I8X3
281687.CJA09705 CJA09705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]