SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA10476 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA10476
Domain Number 1 Region: 50-165
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.62e-21
Family Galectin (animal S-lectin) 0.0043
Further Details:      
 
Domain Number 2 Region: 170-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000475
Family Galectin (animal S-lectin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA10476
Sequence length 368
Comment (Caenorhabditis japonica)
Sequence
MASILRRILSVRKPKKVLTRKDSITGRNHTFRICYRWPWPNFSSISFFSGSEGFIVNLTS
GPNVELDEEDVGELDDRLLALRVDLPKGKVFLNACINGQWGKQAFVKQSYKEGDEFDIRI
RCFEKHFEIYVEHKLIANFKHYVPMSNISHIYVTGDVRLYAVSWEGKLYNMPYTADIPGN
FYVGRKLFVSAIADAKPKDFSIDFFAGDDVPFRVCASFVQKKVLRSSEISGSATTPETTY
EGKIKFPLKAKRSFDILRWLNIQNLNVKIQVFFNDKKKQNSPSAESNPPPPDFSSQLHTT
RPPLLAEYCLPRAVIKTVVAVSILMTSKRHGTFSYWNNFRSFGNFCIPNLLIDFLVSCQK
QFLELPIF
Download sequence
Identical sequences CJA10476 281687.CJA10476

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]