SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA10766 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA10766
Domain Number 1 Region: 226-296
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.19e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00058
Further Details:      
 
Domain Number 2 Region: 21-104
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.38e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00067
Further Details:      
 
Domain Number 3 Region: 310-392
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.00085
Further Details:      
 
Domain Number 4 Region: 112-197
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000000175
Family Eukaryotic type KH-domain (KH-domain type I) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA10766
Sequence length 448
Comment (Caenorhabditis japonica)
Sequence
MVSGDLIPAKKPSEDGVLSNTINSNMDDVDKVVDIYQVPEKVVGLVIGKGGSEIRQIQQS
SGCRVQMDPDNQSVNGFRNCTIEGSAPQVALARQLITGVIARNQAGQPGGPSGGEVTEEM
LIPAEKCGLVIGKAGETIRTIQQQSGLRSCNVVQDSSAPTGQPKPLRMVGIPAAIETAKA
LVTNIMNNVTTAQQLVGAAAASSQIRQGGPQHHYGGGYGGTNEAQAKGEVIVPRVSAGMI
IGKGGEMIKRLAQETGTKIQFKPDENPSSEDRVAVIMGTREQIYRATERITEIVNRAIKN
NGGPSSGQSSSTVTLPGQNVFWMHVPANKCGLVIGKGGENIKQIERETGASCGLAPASEQ
KNEDEKVFEIKGTPGQIHHASHLVRIKVGEIAPNTPVPPMAGQTFGQPQQKMYGGGFLGN
TFATQQQPQIQQQYGEFLAKLNIFSRHT
Download sequence
Identical sequences CJA10766 281687.CJA10766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]