SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA11589 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA11589
Domain Number 1 Region: 22-125
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000122
Family Growth factor receptor domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA11589
Sequence length 146
Comment (Caenorhabditis japonica)
Sequence
MKVSVLILSLFVTGALSKCISHSDCFNHETCVHGECINMWASRFLFDRRCLACPDGYFCS
RGKCFPVTKNLISINIANVCSTGADCDDQSDCIDGKCVVSNGSGGLCSGDAWCPDGYTCV
DSKCQAAKRHFLPYLYRQKGGARVFY
Download sequence
Identical sequences A0A2H2IBX0
CJA11589 281687.CJA11589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]