SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA12067 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA12067
Domain Number 1 Region: 5-104
Classification Level Classification E-value
Superfamily POZ domain 2.55e-21
Family Tetramerization domain of potassium channels 0.0091
Further Details:      
 
Weak hits

Sequence:  281687.CJA12067
Domain Number - Region: 139-149
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000136
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 186-224
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0719
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA12067
Sequence length 261
Comment (Caenorhabditis japonica)
Sequence
MPPQPVITLDVEGVFFKTRISTLKSIEGTYFSRLFETDWREQLDREGKLFIDRDSSVFPV
ILNFLRDHEKCPLPNDEYHLMRLLREAVFFKIGPLRNLIEHKLRTSFGSSCTCPPELPST
PIPATVQKENIPRILLSKPPPPPPPPPPPSLIQKEIVQIPMRKPPVDRSSKKVKKSAVDS
ISLPRNFTHIAHVGWNGASVLFDKKMSDDPTVKKICDAAAEAVDLNAVYNVVNKNDAEES
HSVEVLITGGVMQSRDGTSRH
Download sequence
Identical sequences K7H488
281687.CJA12067 CJA12067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]