SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA12358 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA12358
Domain Number 1 Region: 44-142
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.0000000000156
Family Calponin-homology domain, CH-domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA12358
Sequence length 230
Comment (Caenorhabditis japonica)
Sequence
MNDSRKRDVLQHRTKANYQVIDWVQKTAIAEESERKAIPGKDQSTTRNQFLGFFKDGDVL
VKLANALEPSAVEVATAEENADAAAQKEVQKKNIDAFGAWAQKALGTESAPISADDLLEK
GKSGYSAVFQTLWQLGVGAKEKFDKEGFNVDTIVQLANTVVKSGLLNTILGFFRVKKPSS
RRRCRRAKGGRSCSGCRGRRQGGERWRDCRRADRRETGDVSSGSRVGQLE
Download sequence
Identical sequences CJA12358 281687.CJA12358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]