SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13580 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13580
Domain Number 1 Region: 10-59
Classification Level Classification E-value
Superfamily SNARE fusion complex 0.000000000000236
Family SNARE fusion complex 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13580
Sequence length 65
Comment (Caenorhabditis japonica)
Sequence
MENGKGMKSDQQNGKINTIQDQVESVKAIMVENVDRILERGQQLDDIERRTEQLNATVRY
YIELL
Download sequence
Identical sequences CJA13580 281687.CJA13580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]