SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA13852 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA13852
Domain Number 1 Region: 975-1081
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000143
Family DNA-binding domain of rap1 0.087
Further Details:      
 
Domain Number 2 Region: 256-295,334-449
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000317
Family Laminin G-like module 0.058
Further Details:      
 
Domain Number 3 Region: 77-119,146-232
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000202
Family Laminin G-like module 0.088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA13852
Sequence length 1348
Comment (Caenorhabditis japonica)
Sequence
MAASAYRLKAWKRGAAGILYVSDFDPIRIHAPTDRMRTWERGLKTDQKRMGRGWDVHLSE
EVNLTLTLNNLNIVSQCTVRSKPGTEFGDMRWIQVAISHDAKSSQLQVDDAACTIRASRV
LSELPIQSLHNVYNAEIVRPPVGNAAPIRPDPYTFTFVGNVDTGAKTNDGSIILKPKYDS
PIPRFYGCLRGLLVNGELLDMREMAEKLATSEMYDAYGPAQVHTGCDVGCSTISCSNGGH
CSVAWTNTDPSADKTTCDCSRTSYSGATCSLDEGIHLAKNAFLEFDVSIEMDRVFDFLDR
NNRIPQILKFAFSSPAPIADADTDEDDDGLEEKAVLASVTFREKRKLEIEINPNHTINVA
ITYENGRADVLNFDGDFLDGYRHFVVVQTNQATATAVMIDSLRQDFEYRDSNIDMFSART
VRIGGRFSETDGDNKIGFEGCVSNFLLDYQRGAALSYSPIVYYANPFHHLNRLITDKDVA
LGSCADFEVPNSLPVYQNRVKFPIWDTDFKRFIYTDKIETPTDDSDWTSEDSGSLLWIVI
IILLLALVFLILFCIFMKCCRERVHARETYIHDEDIPLNLTPTIMRHPQPSPPPQKQSAA
SNYHIPNPNVDFNKRSIMTLPHHQLKKTRLQTNRDSTKLDYTLLRSTLCSSSCTFLFPRR
PPRLLFPTSTSVHVSSRGSVPQDEHHSRATSITSSGLSGYYTAQELPYGSDDDDDETLRY
GAEGDADDSDQDTIRHIDDEVQDEDGMVIVRGLDVELGGELEGDSNGNLDDDLDVDLDGE
SDGDIDGDLDNELDYEVDSDPDDEQDCGLGVDLDINLDIEIKNILDDNLEADLYADLDDD
CHGCLAVGLDGDLLVDLDGNLGVDLNSDLTVDLDGDLDLDLDGGLAADLKGDLDDDLNND
LDVDLADSLVDGLDSDLAVGLDGNLGGDLNGDLSGDLSDDLDGDVDGELDVDLVGDPTGG
PDGDLDTMVRPFGKKTFTVDVRKSIVRGHELGAHPKILATQFGCFSSQIYRILKNNRDDD
GIVHRHSPGRPRTTSRAMDRNILRACREHPRRTSTDIQVSVTSPNEPVLSRRTIRRRLQV
AGLHGRRPVKKPLVSLKNRKARFEWAKQHLSWGPREWANHIWSNESKFNMFGTDGIQWIR
RPIGSRYASQYQCPTVKHGGGSVRIVGTMDRYVFEDILENTMRPWARANLGRSWVFQQDN
DPKHTSDHVANWFRRRRVDLLEWPSQSPDLNPIENMWEERERRLKVVRASNAKQKFAQLE
AAWKSIPMTVVQTLLDSMPRRCQAVIDAKGCPTNSRPTQVNHLPRRVSSFRSGDPTAPID
SPLYAVPRKPAPPVHATTPVPPPRIMQQ
Download sequence
Identical sequences 281687.CJA13852 CJA13852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]