SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14118 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA14118
Domain Number 1 Region: 10-99
Classification Level Classification E-value
Superfamily PapD-like 3.27e-18
Family MSP-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14118
Sequence length 138
Comment (Caenorhabditis japonica)
Sequence
MLYDFDDHNLFITPKIAYFPTATGGASRHMMVNGSSHRIAVKIKCSDNELFRVSPVYTLL
EPGNAQRLQIVRDPGPAKVDKIVLIYKTTCSSSARDAFDCDLGAERKVIALIAKEDLTMS
IAPTTNLKSILRQSVQKS
Download sequence
Identical sequences A0A2H2IFU8
281687.CJA14118 CJA14118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]