SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA14405 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA14405
Domain Number 1 Region: 338-492
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.75e-34
Family Protein kinases, catalytic subunit 0.00037
Further Details:      
 
Domain Number 2 Region: 130-235
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.14e-21
Family Eukaryotic type KH-domain (KH-domain type I) 0.00046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA14405
Sequence length 514
Comment (Caenorhabditis japonica)
Sequence
MDPYRGGGRGRGGFGGRGGGGPPGRGGYSDFGGGHHGYGGHGGFDPYNPYGGPQGGYGGY
PGGGFQDMSSPLDAEIQAVLREIHTEVVGLDASGDQFRNARRLLNSEKEKLENNIDPEWL
EVDIAKPVKVCKKVLIPIYRHPNFNFIGKVLGPKGATLQTLCKTHKCHIYILGRNSTKDR
EKEAELLASGDPQHAHFSGPLHVKVETVAPAYVAYGRVAAVIEELSRILQPIHEDTTPAH
LKNGDGGEQKEGEKKEGEEEEGGSGGNGETAAEGGGGRGGRGRGGRGGPGGRGAPGGRGG
FGGRGGFRGGDRGRGGRGGFGGFGGPMGQGRGRGGPGARHEKTEKWYVIKTILSQNTDRK
EYEKEILAYEECSKSDYIVGYHGCEVSSSRKELVLEYMDRGDLRPFGALPYPVHLQVALS
LIRAIRHVWNSGPGYIHRDIKPENILCNSNGYVKLCDFGTAKRIDNTYRIAHSAAGTELF
QAPEQRLGHDYRSLSGKLIRPQFYHWPNSITGLT
Download sequence
Identical sequences 281687.CJA14405 CJA14405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]