SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA15132 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA15132
Domain Number 1 Region: 445-544
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.19e-19
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 153-227
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.46e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.00034
Further Details:      
 
Domain Number 3 Region: 587-660
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.21e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 730-805
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000143
Family Eukaryotic type KH-domain (KH-domain type I) 0.0016
Further Details:      
 
Domain Number 5 Region: 953-1022
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000146
Family Eukaryotic type KH-domain (KH-domain type I) 0.00065
Further Details:      
 
Domain Number 6 Region: 1030-1101
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000321
Family Eukaryotic type KH-domain (KH-domain type I) 0.0018
Further Details:      
 
Domain Number 7 Region: 802-878
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000336
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 8 Region: 654-730
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000107
Family Eukaryotic type KH-domain (KH-domain type I) 0.0003
Further Details:      
 
Domain Number 9 Region: 297-372
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 10 Region: 875-951
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000057
Family Eukaryotic type KH-domain (KH-domain type I) 0.0014
Further Details:      
 
Domain Number 11 Region: 1096-1178
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0003
Further Details:      
 
Domain Number 12 Region: 231-300
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000000000351
Family Eukaryotic type KH-domain (KH-domain type I) 0.0032
Further Details:      
 
Domain Number 13 Region: 360-436
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000234
Family Eukaryotic type KH-domain (KH-domain type I) 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA15132
Sequence length 1250
Comment (Caenorhabditis japonica)
Sequence
MDNGHTEETNTVEVDPATGGVVMSFSYASDFPTLPEAAPATAPTAKQTNVWHRSNLSKAD
VTITFRLASDERSNKVKSFGNTSEESKKAQQIASQTSMFLFCFYFSIFVLSKLVFVKYLF
AETRIELSESKDGELTVVVKGERAKAEEARARIVRDLQTQASRELDIPKEHHGRLIGKEG
ALLRSLEADTNCRIQIPARDGPSSIITITGPREGIQRAAAHILAVSEREAKLATEHIVCP
KNLVPFVRGPFNETYDSLTLEHGVKINIPPSHVANEVISVTGEKEGVFRAAAEIRKIVES
KKNPSTIQVQVARTQHRYIIGQGRSGIHEILRNARVVVEVPSEESGSDQITLIGDAQDLA
GALQLVIERASSVVTQSIAAPNWLHKHLIGPKGSTLSALVPNREKVQIEFDDSNHIFIEG
APVEVKAAHEILAKEVARLQIELAIEKVKVHPSLHRHVIGRGGSLISKIKEQTGVQVTIP
NEETNSDEIVVEGKKDGVKKAVAEIRAIVTKIENEKSRDIIIPQRLHKLIIGSKGSGVQA
IRDSYPNVSIGFPDAKSKSDVVNIRGDKAEVDAVFKKLTTLSKEYAENNYQETVAIFKEF
LKHIVGKGGASIRKLRDETETRIDLPEAGSDDGKITVTGKQANVEKAVAQLNKIQEELAN
VAEETIEIPTKVQARFFGNGRRLIADIEEECGGVHIRFPSEKSESTKVSIRGPAGDVTKA
VALLSALAKDKEENYVEDTVKAKPEFHRFLIGKGGSKIAKLRDTLNVRIMFPKEGEAEKE
IIHLLGKKDDVPKAKAALEEAIKQLSETTDIKIQVDPKYYKNFLAHGATVVKMIQEQNGG
VVISFPKNGSDSDEVSIRGSKQCVEAAKARIEDIVDDYEKQITSTVAIPTQFHRGLLAGR
GAKIHELQSKFNVSIRFPNNREEGAEGSDQVSVSGRDTKVEEAKEALLALVPISKVIQLP
IDMHRSIIGRGGETVRKLMQDYDVNISIPKDNSSEDITVTGQVANVDQALEALREKLVEY
EALAEDRKLKQWSMTINVPTDYHQKIIGQRGQTITALKEKFGVIINVPREEGNEAITIQG
YEEKANACAAEIENMISELRSMFTQEISLDARYHPRLIGQRGRNLKKVMEDFRVEIRLPR
QGAEDPNLVIVAGKDENDVYDCIDFLRGEEEEFLLDNVERVSLRLFTQYLSPRHQETNNS
RQHQAPVTVQMKGAPWQLDIGSSEQFPDMGAESGASATAVGGAWGSSRRW
Download sequence
Identical sequences CJA15132 281687.CJA15132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]