SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA15185 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA15185
Domain Number 1 Region: 28-183
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000095
Family Clostridium neurotoxins, the second last domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA15185
Sequence length 204
Comment (Caenorhabditis japonica)
Sequence
MNSLRSLFSCLTPCFDCVEGSSFDNMSYPRFNAVYQPTVRLDVGRMGKNVVILKEGERIC
GIGGAIATVPIVQNKAYFQATVQQTGTWGIGLGQKQSPFDTIPCTEKFWGIRDNGDIAKE
NEVIGKMTKTVEEGDVVGVTYDHVELKFYVNGKEVEEGIITGVKGPVYPMVYVDDSAILD
LKFKNFTEAPPTGYGEILVEQTIL
Download sequence
Identical sequences A0A2H2IHK2
CJA15185 281687.CJA15185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]