SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA16103 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA16103
Domain Number 1 Region: 85-214
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.87e-37
Family Calponin-homology domain, CH-domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 288-346
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000017
Family EB1 dimerisation domain-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA16103
Sequence length 368
Comment (Caenorhabditis japonica)
Sequence
MYFNVLFLFSTQFSYFNAKSPEFSQKILFVTKINNFVDLSQLFRSFYFLIQHFGFPAYVA
WRQADLIYTPPKLSIFKGIPRQKMVVNVFISAVTTDTLSRKEAVAWVNNLLKSHFTKVEE
MASGAAYCQLTHLLFGACNLRKVKFNPRNEPDILNNWKVLTTAWKELGVDKPVDVEKMKK
AKFQDNMEFLQWFYKFFNANLTTDPAEYDAVAARGGEALPALKGAAAGARPAAVAPRPVA
VAPRPVPVASKPAPVAKPAAQAAAVVKNGSNEALIKENEQLRAEVDQQKLLAAEWESMAK
DMEAEREFYFAMLQKVEGLAHEADELKSATIDVEALKMVLYEKGEEPEQPAAEEDGALPA
NLDDTETF
Download sequence
Identical sequences CJA16103 281687.CJA16103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]