SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17020 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17020
Domain Number 1 Region: 4-100
Classification Level Classification E-value
Superfamily POZ domain 2.55e-26
Family Tetramerization domain of potassium channels 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17020
Sequence length 224
Comment (Caenorhabditis japonica)
Sequence
MTTQIVKLDVGGTVFKTSLFTLSQHDSMLKTLLTTGMPVERDENGCVFIDRDSKYFRLIL
NFLRDGFVDLPETRSEVLEILAEAKYYLLQTLIDCCEERLRQTYIPNYYVVTFVVEARKF
IFGSDKPVIVLRLPINIGTTGIVSSYYFSEKRFEELADQHHESITFVLVTEAEFTEDCSW
SFFLQNKRVSIRVKGPSDNNMIEDCMWEVLEDAKRRRQTHSKLV
Download sequence
Identical sequences A0A2H2IKB1
281687.CJA17020 CJA17020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]