SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17715 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA17715
Domain Number 1 Region: 449-600
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000206
Family MAM domain 0.017
Further Details:      
 
Domain Number 2 Region: 182-342
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000411
Family MAM domain 0.049
Further Details:      
 
Weak hits

Sequence:  281687.CJA17715
Domain Number - Region: 59-64
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0471
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17715
Sequence length 600
Comment (Caenorhabditis japonica)
Sequence
MISYLLLSLFLFHQPGPGDSCQPPMPASSFQSNGLPMTVPASPQYIPVNGLDQSAPIPPP
PPPPASNSVGGSDQLEMINEPDRAVKMVREITPYPGYIPPPPAPSESVAASPSQSSNFPT
LIDNSEIPQNHVRSSHTFRSDTPLQLLSPSSQRELSCPFELSTITDFLTCIRRLSTVTLD
EHNISCDFEKDSGCRFKSISSPLSVGNFASMDHYRTFATLANRLEEQKPSGNFVFFIEHR
GTDPEDEFIMSTPITCQKGNGVLKFDYWIVGKPNSVMLRVCTQNHLSRSCTQSIAYNSAT
STLAIEVVHPNSTFFELEIVASNLVDPTVIVYDNIEYKAELCEFDQAQKTVATGEEMLTD
DTIEEKPETSVDSFFDDEERQEETVEKNKDAKEEDGVTEESVPVPSRPIRLSPRRAEMEK
QVSALIDDRDEALEDSENRDEPQSVCKLLSCDFDQSMCLFNNYVNESMSLSPWQLGNNRV
GNPHTGVREGSGFLYVGTDSSTDSKIINYILESPDLSVEEDVNLTMDIYRRSNDITLQIC
LDTPFYCPYSLTPFDKETSWKEGEMFLVPRGTLKVYIKAIQWRKFKWLAIDNLRVVSASC
Download sequence
Identical sequences 281687.CJA17715 CJA17715

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]