SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA17781 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA17781
Domain Number - Region: 9-57
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit B, membrane domain 0.0017
Family F1F0 ATP synthase subunit B, membrane domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA17781
Sequence length 126
Comment (Caenorhabditis japonica)
Sequence
MASQTQGIQQLLAAEKRAAEKINEARKRKLQRTKQAKQEAQAEVEKYKQQREQEFKAFEQ
QYLGTKEDIESKIRRDTEDQISGMKNSVASNKQAVIVRLLQLVCDIKPELHHNLSLQKKL
HGQFAA
Download sequence
Identical sequences A0A2H2ILN9
281687.CJA17781 CJA17781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]