SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA18034 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA18034
Domain Number 1 Region: 134-223
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.27e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0036
Further Details:      
 
Domain Number 2 Region: 45-117
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000701
Family Eukaryotic type KH-domain (KH-domain type I) 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA18034
Sequence length 430
Comment (Caenorhabditis japonica)
Sequence
MKEEQVGQKMPGSWFYEEDTTSCSPVSDPEDIAQFLNYRASIGVQNVTQSVEVPTSEHVA
EIVGRQGCKIKALRAKTNTYIKTPIRGEDPIFVVTGRLEDVQEAKREIECAAEHFTQIRA
SRRHSQVVPGAHAPGQVTSYVRVPLRVVGLVVGPKGATIKRIQQDTHTYIITPSREREPV
FEVTGLPHNVEAARKEIETHIFQRTGNLPETDHDVPGQYVGVSMLQQAQQHQQQQSTAAS
ASASAAAAATLYRKAFSNSNIFNQLNNDLPHGMESSLGLDALFRSFPSMRNSLTSETLQG
LGRSSAGNMPAKSRPSLGGQPTKPEVPTYDYWGNNNSINDIMENEILSRNYNALSAWSSL
GENKEKREESPINGLMSLKSGSSSTSGFGFLNTIWSDNLNLSPGSLASASASPASSSCDH
NDHTLVPING
Download sequence
Identical sequences A0A2H2ILX1
CJA18034 281687.CJA18034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]