SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA18586 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA18586
Domain Number 1 Region: 202-325
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.97e-33
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA18586
Sequence length 461
Comment (Caenorhabditis japonica)
Sequence
MPSCTTPTFGASQLEIGSGDSPSRESVMTPTSLDDDTPRKKFPTLETGDRWPMYRRDGWS
SLRAPPPARLSLSTNHKNFMSPISSAYSQTPNSLLSPAMFNKHRSIFSPTLPSTPMSYGK
VSLDSKSNLFSPAPTEPVEVEATVEYLADLVKEKKHLTLFPHMFNNVERLLDDEIGRVRV
ALFQTEFPRVELPEPAGDMMSITEKIYVPKNEFPDYNFVGRILGPRGMTAKQLEQDTGCK
IMVRGKGSMRDKSKESSHRGKANWEHLEDDLHVLVQCEDTENRVHIKLQAALEQVKKLLI
PAPEGTDELKRKQLMELAIINGTYRPMKSPNPARVMTAVPLLSPTPLRSSGSVLMSPTHG
NTGLPATTLGGSILSPTLTSNPLIGSNVFDYSSFINQGMFDSFNSLQLSDLTFPKYPTTT
SFVNSFPSLFSSVASSAASQNMTCSPSSGDSSTASNNNTSF
Download sequence
Identical sequences K7H9N1
CJA18586 281687.CJA18586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]