SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA20681 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA20681
Domain Number 1 Region: 65-127
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000617
Family Calnexin/calreticulin 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA20681
Sequence length 132
Comment (Caenorhabditis japonica)
Sequence
MLNRKWVTHVIFLQLLLIAAVRTTDEDGFDNDNEEEEQIVQGSDDREDQFVPSLFVAPKL
GESSKPNFFDYFPVGSKIGQTWIKSLAKKDDVDSDIAKYNGEWSIGAPSKVSIEGDLGLI
VKTKRKFGKCSV
Download sequence
Identical sequences CJA20681 281687.CJA20681

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]