SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA21713 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA21713
Domain Number 1 Region: 7-155,293-399
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.41e-63
Family Calponin-homology domain, CH-domain 0.0000757
Further Details:      
 
Weak hits

Sequence:  281687.CJA21713
Domain Number - Region: 468-579
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00368
Family Spectrin repeat 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA21713
Sequence length 1114
Comment (Caenorhabditis japonica)
Sequence
MSSSPPARPCCVCFRFKPYEDEKAQKNTFTRWINFHLEEHSSSGRIEDLFEDIRDGVLLC
HLIEVLTGEALQILRRTKPSLATLHENHAVHKGRVSKRVHHIANLTTALTVLRRRGLELI
NNNAADIADGNPRIVLGLVWQIILHFQVCCGAVRLALFEEEISGALSKTHKSPTTPSTSQ
GRHRRRRRFFLHCDDDLLLYVVEVNEWYSMIETNIILLREWGWASTQTEEPSTSQPEVVV
TAPSPTPSKKSHKSSLSGSKTSIASGEKAPASPLRQRIASFLTPTKKAPKLSTIPVKQSV
EQVFLRWINAEIGDLVGGRRVENMDRQWRDGVLFCALVSRWRPDVISMKEVSNANPRDNL
EMAFNLAHQHLGVRRLLAVEDIMTEKPDKRSVITYVSQFVRMFGERSPLQGREQHEVFLA
WLEATYLLCTRHDLNSQECARIRREFIEHRPLFNTIIVTKVNYDVDELVEIENKWDAIRE
TLEKYARRAERNLPEPFASIATWLAGAEHILSRPLTLDAHDAPKTCQMLQKLISEHQKCM
EELPGKREEFENAAQHGGLGGRPAAPEFSEPLRARFAQIEEENEPRIATLRILLTHYILL
QYLQNIDEKINLWRQFFGISSHCFLPPHLIDTPKYTVFRTADSVTLLLRWIKEYTQLNAE
NPQAKCAAYLNKLELAMNNDQSSKLDKEAILRSSKEKVAETLKRFESLWPELQSLKGEWV
DWETHVSRLEQTVDERKSNGIAPSSDDEQELTKIITGADQLAPKLGASARLSNNQRVDVL
VNSFKKLTKTTIKIGGRLVVELEPTTSAQAAKISFSEQASDELLKVEMQLRDRQHREIAD
SENLEFRAETFRTIRDKLVELERLNELYEAHSRDQVDTVDRNLIRTDMGTIIYGLQAGEY
ANFVDLSHYAFVFDEYNQKPVTLTEHVLSEEYVREIITRKTAILARRERNEQEIRASIRD
MEECDRIIEGWQSKELDELRATWNVKLSEFEAWHEMMRQVEVLAHTIETRLDVSVIQTIV
VLKERSTDIKHSELGGALREALEQLATTSESAVHRHLQNLELSNEQDCADAIEFLEHQLF
PFKGEVIFNKKECIVQPHVPIHDEWEKGSNASID
Download sequence
Identical sequences CJA21713 281687.CJA21713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]