SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA22749 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA22749
Domain Number - Region: 1-48
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.000575
Family Calcium ATPase, transmembrane domain M 0.044
Further Details:      
 
Domain Number - Region: 41-65
Classification Level Classification E-value
Superfamily HAD-like 0.00181
Family Meta-cation ATPase, catalytic domain P 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA22749
Sequence length 69
Comment (Caenorhabditis japonica)
Sequence
MIPISLYVSIEFIKIFQVWFMSQDRNMYYDKVDKRLQCRALNITEELGQIQYVMSDKTGT
LTENQVPIK
Download sequence
Identical sequences 281687.CJA22749 CJA22749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]