SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23035 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA23035
Domain Number 1 Region: 169-289
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000017
Family Calponin-homology domain, CH-domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23035
Sequence length 431
Comment (Caenorhabditis japonica)
Sequence
MDFPLPALLAIEDYDENEGKLAASIRWLISRVYEEKRDMPDKLRDGVQRDENGHFQISEA
VLGALCNGSLYAQAAAKIFKESALVTKGHGAVLAVLTDYGIDVLVDGEEPVEEAQLAAAA
PFNMSAHLAIIDSLMMAHLRDVIPVSRVVEAVSRHTAVESSEKPIDSVDALLFWINKICL
LVRDDVERTDPDTNIPEMEDLYEDISDGQCLCALLHWYRSQEMPIADISFNEAATTRDCQ
YNLMLLQQFCHHHLANDPFHFEIEDLLYLRDSLQMNVNAFLADLFIQFEPPVTPEPVETP
RVGPSPRRFVPASAIPDLRAANAAARSSIHNRNRSRIYNPPPMALQSQGPSRSVSRMSQD
SLFYSRPASIALQRRSMDQDSVTDFQTIRQNFENQAGTAQLNRYDGSATASVRLAMEEKR
RKHDQQMAQMK
Download sequence
Identical sequences 281687.CJA23035 CJA23035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]