SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23381 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA23381
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.31e-33
Family Calponin-homology domain, CH-domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23381
Sequence length 162
Comment (Caenorhabditis japonica)
Sequence
MSAFASSERAEKSGIALEAQQKIYEKYDKNLAGDILQWVQGITGQSFDTNGDAENFVRVF
QDGSLLCNLANALKPGSVKKVNTSAMAFKKMENISFFLKFAEEFVQKSELFQTVDLYEGQ
DPNAVLICLASLARKAEKFGRDGLGPKEAQGDRREWTDEQLK
Download sequence
Identical sequences CJA23381 281687.CJA23381

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]