SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23401 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA23401
Domain Number 1 Region: 11-63,98-165
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00000000000368
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23401
Sequence length 198
Comment (Caenorhabditis japonica)
Sequence
MVQVNPPLKDQVIERDLHLIRKTFEAVIENASCQVFGSYASSVRKNGYSDIDLNVESIDT
PEKPGSTTIRPLQQLVDDRTCLFEKPLTKAELYSFPPEDIIKALYRSFNRSVEIKKEFKL
RYLPARTPIIVFTSRFMDGIFNVSFDISVNNRVSVQKAELLDWFMTQDCSKNKRTGKVMK
FLVHWAKCNGLMSGSIRG
Download sequence
Identical sequences 281687.CJA23401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]