SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA23671 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA23671
Domain Number - Region: 5-31
Classification Level Classification E-value
Superfamily SET domain 0.0654
Family Viral histone H3 Lysine 27 Methyltransferase 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA23671
Sequence length 77
Comment (Caenorhabditis japonica)
Sequence
MIIQLTLDYGPGYVTDQLENNCKCESFACISGEHFKKYNQMDYAELGRCFQSAAQRQYEF
WQEKVYNEGMEMGRRKS
Download sequence
Identical sequences K7HC12
281687.CJA23671 CJA23671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]