SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA26995 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA26995
Domain Number 1 Region: 15-111
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000000494
Family BTB/POZ domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA26995
Sequence length 175
Comment (Caenorhabditis japonica)
Sequence
MSVQDCPEVLRFSLQILATSSKFFHALFYSKFSESSQQEIKLVDVKHLEFVDFLNLIYPT
HKCIDGRCISEFSPKKIGFKNSEDNVEHLLKLADRLEAPSVLEKCEEYLISSNEVHKVMK
LKYAEIYKLSRLQDKCLNTITSRQDIVTLSKHEDYKSLGDCTYNVLLQKMIELNC
Download sequence
Identical sequences 281687.CJA26995 CJA26995

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]