SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA27044 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA27044
Domain Number 1 Region: 19-97
Classification Level Classification E-value
Superfamily POZ domain 1.41e-17
Family BTB/POZ domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA27044
Sequence length 163
Comment (Caenorhabditis japonica)
Sequence
MYFYLSFSCCNSIENTIQYLALYSPVFYAMFFSNFQEREKTQVELEDVAIDEFRELLHVI
YPCHKPVTVENVEYLLELGDKYEIQYVMDECERFLMSATTEEVPLITKLVWADQYLLAKL
QDSCLRNIKCVADVKTIRMTEEFKNLSDATKAALLEKILKIVD
Download sequence
Identical sequences CJA27044 281687.CJA27044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]