SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA27636 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA27636
Domain Number 1 Region: 2-134
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.47e-36
Family Calponin-homology domain, CH-domain 0.0000139
Further Details:      
 
Domain Number 2 Region: 193-251
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 0.00000000327
Family EB1 dimerisation domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA27636
Sequence length 268
Comment (Caenorhabditis japonica)
Sequence
MVVNVFISAVTRDNLSRKDAVAWINDVLKKFQSHFTKVEEMSSGAAYCQFTHLLFGVINL
KKVKFNPRNEPEVLNNWKALTTAWKDIGIDKPVEVEKLKKGKFQDNMEFLQWFYKFFHAN
LSDQLVNYDAIGARAGEDLPALKGVTRAPPTARSVATAPAPAPTRNVVRPSAGPRPVPSR
NDTIVKELEVKCEEQKALATQWEIMAKEMETEREFYFNMLQKVEELVNSADEQQESAIPI
ESLKKVLFGENREEKVGKEDNSDEAYLF
Download sequence
Identical sequences CJA27636 281687.CJA27636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]