SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA28337 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  281687.CJA28337
Domain Number 1 Region: 43-197
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 1.15e-26
Family D-ribose-5-phosphate isomerase (RpiA), catalytic domain 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA28337
Sequence length 199
Comment (Caenorhabditis japonica)
Sequence
MTIRRDIGNDTGPLNCLGGYIIPVQDNGNGSDYVFDFEKDCHANAKMQACAAAVALIEPH
DTVFIDCGTTTPHLAQLIPHNQHITVVCYSLNIAEILSRRDDVRLIVLGGVYHPEAASFS
SDEGIEVLKRININKAFLSAGGVDEQHGVTCSHFHEVPVKQMAMQRALQKHLVVDESKFG
KVRAARFAGVADFNSIVSG
Download sequence
Identical sequences CJA28337 281687.CJA28337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]