SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 281687.CJA28992 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  281687.CJA28992
Domain Number - Region: 15-44
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0111
Family Galectin (animal S-lectin) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 281687.CJA28992
Sequence length 52
Comment (Caenorhabditis japonica)
Sequence
MSQPSAPPDDDSSTIRSPELPFVSSIVGGLFAGRAVVISGMVLPGFAADRKR
Download sequence
Identical sequences CJA28992 281687.CJA28992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]