SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 282458.SAR1648 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  282458.SAR1648
Domain Number 1 Region: 53-288
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.44e-39
Family Tandem AAA-ATPase domain 0.072
Further Details:      
 
Domain Number 2 Region: 12-69
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000633
Family Eukaryotic type KH-domain (KH-domain type I) 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 282458.SAR1648
Sequence length 315
Comment (Staphylococcus aureus aureus MRSA252)
Sequence
MPGIIQIDDMNQSQALIGNNDEHLKAIEESFDVVIHARGQEVAVKGTKIENVEKAESVLI
NLLKVIDLGNNITIKDVEAAIKMAHNNTIQHLLDLYDEEITKDAFGKTIRAKTMGQRIYV
NAMKNNDLVFGIGPAGTGKTFLAVVYAAKQLRKGTVKRIVLTRPAVEAGESLGFLPGDLK
EKVDPYLRPLYDGLYTVLGREQTERFIERGIIEIAPLAYMRGRTLEDAFVILDEAQNTTH
AQMKMFLTRLGFGSKMVVTGDQTQIDLPKGVKSGLKEAVSRLHNVKGISILKLDQSDVVR
HPLVSKIIEHYEGEN
Download sequence
Identical sequences A0A0E1X4Z9 A0A0Z0FZP9
282458.SAR1648 gi|384867455|ref|YP_005747651.1| gi|532359663|ref|YP_008449492.1| gi|49483819|ref|YP_041043.1| WP_001117769.1.101458 WP_001117769.1.101758 WP_001117769.1.101775 WP_001117769.1.10408 WP_001117769.1.10969 WP_001117769.1.11894 WP_001117769.1.12158 WP_001117769.1.12555 WP_001117769.1.13307 WP_001117769.1.13505 WP_001117769.1.13709 WP_001117769.1.13807 WP_001117769.1.14221 WP_001117769.1.14272 WP_001117769.1.14314 WP_001117769.1.15641 WP_001117769.1.15712 WP_001117769.1.16026 WP_001117769.1.16083 WP_001117769.1.16214 WP_001117769.1.16408 WP_001117769.1.16414 WP_001117769.1.16564 WP_001117769.1.1666 WP_001117769.1.16802 WP_001117769.1.17524 WP_001117769.1.1811 WP_001117769.1.18132 WP_001117769.1.1849 WP_001117769.1.18526 WP_001117769.1.18605 WP_001117769.1.18799 WP_001117769.1.18870 WP_001117769.1.19370 WP_001117769.1.19928 WP_001117769.1.20201 WP_001117769.1.20307 WP_001117769.1.20496 WP_001117769.1.2079 WP_001117769.1.22512 WP_001117769.1.22787 WP_001117769.1.24347 WP_001117769.1.24388 WP_001117769.1.24502 WP_001117769.1.24597 WP_001117769.1.24644 WP_001117769.1.24780 WP_001117769.1.24817 WP_001117769.1.24856 WP_001117769.1.25187 WP_001117769.1.25488 WP_001117769.1.25495 WP_001117769.1.25591 WP_001117769.1.25597 WP_001117769.1.25744 WP_001117769.1.26315 WP_001117769.1.26650 WP_001117769.1.26886 WP_001117769.1.27097 WP_001117769.1.27120 WP_001117769.1.27127 WP_001117769.1.27415 WP_001117769.1.27622 WP_001117769.1.27662 WP_001117769.1.27673 WP_001117769.1.27999 WP_001117769.1.28298 WP_001117769.1.28388 WP_001117769.1.28691 WP_001117769.1.29170 WP_001117769.1.29250 WP_001117769.1.30150 WP_001117769.1.30188 WP_001117769.1.30294 WP_001117769.1.30690 WP_001117769.1.30768 WP_001117769.1.30861 WP_001117769.1.30945 WP_001117769.1.31114 WP_001117769.1.31363 WP_001117769.1.32106 WP_001117769.1.32269 WP_001117769.1.32898 WP_001117769.1.33277 WP_001117769.1.3358 WP_001117769.1.34307 WP_001117769.1.34438 WP_001117769.1.34578 WP_001117769.1.34877 WP_001117769.1.3526 WP_001117769.1.35264 WP_001117769.1.35345 WP_001117769.1.35933 WP_001117769.1.36820 WP_001117769.1.37336 WP_001117769.1.37343 WP_001117769.1.38491 WP_001117769.1.38651 WP_001117769.1.38669 WP_001117769.1.39080 WP_001117769.1.39347 WP_001117769.1.39847 WP_001117769.1.39883 WP_001117769.1.40119 WP_001117769.1.40443 WP_001117769.1.40458 WP_001117769.1.41341 WP_001117769.1.41821 WP_001117769.1.41954 WP_001117769.1.42924 WP_001117769.1.43220 WP_001117769.1.4369 WP_001117769.1.4379 WP_001117769.1.44021 WP_001117769.1.44150 WP_001117769.1.44255 WP_001117769.1.44480 WP_001117769.1.44948 WP_001117769.1.45303 WP_001117769.1.46488 WP_001117769.1.46576 WP_001117769.1.46696 WP_001117769.1.47308 WP_001117769.1.47530 WP_001117769.1.47554 WP_001117769.1.47667 WP_001117769.1.48017 WP_001117769.1.48996 WP_001117769.1.4920 WP_001117769.1.49825 WP_001117769.1.50071 WP_001117769.1.50711 WP_001117769.1.50745 WP_001117769.1.5080 WP_001117769.1.51558 WP_001117769.1.51973 WP_001117769.1.52754 WP_001117769.1.52836 WP_001117769.1.52893 WP_001117769.1.53189 WP_001117769.1.5359 WP_001117769.1.53886 WP_001117769.1.54029 WP_001117769.1.54048 WP_001117769.1.54105 WP_001117769.1.54246 WP_001117769.1.54895 WP_001117769.1.55991 WP_001117769.1.5606 WP_001117769.1.56306 WP_001117769.1.56803 WP_001117769.1.56967 WP_001117769.1.57102 WP_001117769.1.57614 WP_001117769.1.57883 WP_001117769.1.58042 WP_001117769.1.58106 WP_001117769.1.58242 WP_001117769.1.5832 WP_001117769.1.58839 WP_001117769.1.59175 WP_001117769.1.5930 WP_001117769.1.59567 WP_001117769.1.59810 WP_001117769.1.60165 WP_001117769.1.602 WP_001117769.1.60289 WP_001117769.1.6045 WP_001117769.1.60704 WP_001117769.1.61534 WP_001117769.1.61899 WP_001117769.1.62416 WP_001117769.1.63047 WP_001117769.1.63051 WP_001117769.1.63120 WP_001117769.1.63143 WP_001117769.1.63190 WP_001117769.1.63228 WP_001117769.1.63923 WP_001117769.1.642 WP_001117769.1.64396 WP_001117769.1.65512 WP_001117769.1.6559 WP_001117769.1.65879 WP_001117769.1.65930 WP_001117769.1.65946 WP_001117769.1.65986 WP_001117769.1.66482 WP_001117769.1.66628 WP_001117769.1.66765 WP_001117769.1.66996 WP_001117769.1.67063 WP_001117769.1.67147 WP_001117769.1.67212 WP_001117769.1.67864 WP_001117769.1.68466 WP_001117769.1.68716 WP_001117769.1.68878 WP_001117769.1.68987 WP_001117769.1.68988 WP_001117769.1.69266 WP_001117769.1.69409 WP_001117769.1.70094 WP_001117769.1.70413 WP_001117769.1.70441 WP_001117769.1.706 WP_001117769.1.71316 WP_001117769.1.7164 WP_001117769.1.71707 WP_001117769.1.7193 WP_001117769.1.72102 WP_001117769.1.72285 WP_001117769.1.72496 WP_001117769.1.73046 WP_001117769.1.73121 WP_001117769.1.73191 WP_001117769.1.7326 WP_001117769.1.73853 WP_001117769.1.74138 WP_001117769.1.74221 WP_001117769.1.74390 WP_001117769.1.74497 WP_001117769.1.74510 WP_001117769.1.74590 WP_001117769.1.74775 WP_001117769.1.74808 WP_001117769.1.75304 WP_001117769.1.76295 WP_001117769.1.76872 WP_001117769.1.76876 WP_001117769.1.77069 WP_001117769.1.78067 WP_001117769.1.78116 WP_001117769.1.78210 WP_001117769.1.78478 WP_001117769.1.79132 WP_001117769.1.7930 WP_001117769.1.79407 WP_001117769.1.79554 WP_001117769.1.79566 WP_001117769.1.80193 WP_001117769.1.80308 WP_001117769.1.80345 WP_001117769.1.80430 WP_001117769.1.81522 WP_001117769.1.81651 WP_001117769.1.81847 WP_001117769.1.82026 WP_001117769.1.82058 WP_001117769.1.82100 WP_001117769.1.82321 WP_001117769.1.82472 WP_001117769.1.82665 WP_001117769.1.82999 WP_001117769.1.83314 WP_001117769.1.83541 WP_001117769.1.83980 WP_001117769.1.84700 WP_001117769.1.84770 WP_001117769.1.85173 WP_001117769.1.85825 WP_001117769.1.86241 WP_001117769.1.8699 WP_001117769.1.87096 WP_001117769.1.87110 WP_001117769.1.87497 WP_001117769.1.8757 WP_001117769.1.87579 WP_001117769.1.87647 WP_001117769.1.87735 WP_001117769.1.87985 WP_001117769.1.88101 WP_001117769.1.88455 WP_001117769.1.88478 WP_001117769.1.88738 WP_001117769.1.88805 WP_001117769.1.88959 WP_001117769.1.8904 WP_001117769.1.89439 WP_001117769.1.89874 WP_001117769.1.8990 WP_001117769.1.90239 WP_001117769.1.90269 WP_001117769.1.90514 WP_001117769.1.90994 WP_001117769.1.91184 WP_001117769.1.91629 WP_001117769.1.92259 WP_001117769.1.92897 WP_001117769.1.93316 WP_001117769.1.93435 WP_001117769.1.93690 WP_001117769.1.9392 WP_001117769.1.94319 WP_001117769.1.94325 WP_001117769.1.94992 WP_001117769.1.95154 WP_001117769.1.95307 WP_001117769.1.95495 WP_001117769.1.95505 WP_001117769.1.96200 WP_001117769.1.96261 WP_001117769.1.96368 WP_001117769.1.96412 WP_001117769.1.96577 WP_001117769.1.96613 WP_001117769.1.98322 WP_001117769.1.98419 WP_001117769.1.99183 WP_001117769.1.99524 WP_001117769.1.99714 WP_001117769.1.99862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]