SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 282459.SAS2383 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  282459.SAS2383
Domain Number - Region: 208-286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00135
Family Legume lectins 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 282459.SAS2383
Sequence length 1371
Comment (Staphylococcus aureus aureus MSSA476)
Sequence
MRDKKGPVNKRVDFLSNKLNKYSIRKFTVGTASILIGSLMYLGTQQEAEAAENNIENPTT
LKDNVQSKEVKIEEVTNKDTAPQGVEAKSEVTSNKDTIEHEPSVKAEDISKKEDTPKEVA
DVAEVQPKSSVTHNAETPKVRKARSVDEGSFDITRDSKNVVESTPITIQGKEHFEGYGSV
DIQSNPEDLKVSEVTRFNNKSIGKNELTGALQLKNKVSFKNDFEFNIRVANNHQSVTTGA
DGWGFLFSKGDGNEYLQKGGILGPKGMENSAGFKIDTGYNFKDPMDKEEKQAGQGFKGYG
TFVKTGADGTTAKVGTNIPTRGKADNSFQYADNSIDTTDGKFHGQLLNNLKLAYNEKSGI
MRAEYAGKIWEANISDLGLDKSEAYNFLITSSQRQGTSQGVYANGWMRTDLNNSTFKLTP
NLVNKTETKTVEIPFETKREFNPKLQPGEERVKQEGQPGSKTITTPITVNPLTGEKVGEG
QPTEEITKQPVDKIVEFGGEKIPQGHKDIFDPNLPTDQTEKVPGKPGIKNPDTGKVIEEP
VDDVIKHGPKTGTPETKTVEIPFETKREFNPKLQPGEERVKQEGQPGSKTITTPITVNPL
TGEKVGEGQPTEEITKQPVDKIVEFGGEKIPQGHKDIFDPNLPTDQTEKVPGKPGIKNPD
TGKVIEEPVDDVIKHGPKTGTPETKTVEIPFETKREFNPKLQPGEERVKQEGQPGSKTIT
TPITVNPLTGEKVGEGQPTEEITKQPIDKIVEFGGEKIPQGHKDIFDPNLPTDQTEKVPG
KPGIKNPDTGKVIEEPVDDVIKHGPKTGTPETKTVEIPFETKREFNPKLQPGEERVKQEG
QPGSKTITTPITVNPLTGEKVGEGQPTEEITKQPVDKIVEFGGEKIPQGHKDIFDPNLPT
DQTEKVPGKPGIKNPDTGKVIEEPVDDVIKHGPKTGTPETKTVEIPFETKREFNPKLQPG
EERVKQEGQPGSKTITTPITVNPLTGEKVGEGQPTEEITKQPIDKIVEFGGEKIPQGHKD
IFDPNLPTDQTEKVPGKPGIKNPDTGKVIEEPVDDVIKHGPKTGTPETKTVEIPFETKRE
FNPKLQPGEERVKQEGQPGSKTITTPITVNPLTGEKVGEGQPTEEITKQPVDKIVEFGGE
KITQGHKDIFDPNLPTDQTEKVPGKPGIKNPDTGKVIEEPVDDVIKHGPKTGTPETKTVE
IPFETKREFNPKLQPGEERVKQEGQPGSKTITTPITVNPLTGEKVGEGQPTEEITKQPVD
KIVEFGGEKPKDPKGPENPEKPSRPTHPSGPVNPDNPGLSKDRAKPNEPVHSMDKNDKVK
KSKIAKKSVANQEKKRAELPKTGAESTQKGLIFSSIIGIAGLMLLARRRKN
Download sequence
Identical sequences WP_001205103.1.28915 gi|49487275|ref|YP_044496.1| 282459.SAS2383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]