SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 283166.BH15920 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  283166.BH15920
Domain Number 1 Region: 1-85
Classification Level Classification E-value
Superfamily L28p-like 3.14e-28
Family Ribosomal protein L28 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 283166.BH15920
Sequence length 97
Comment (Bartonella henselae Houston-1)
Sequence
MSRACELTGKTVQYGNNVSHANNKTRRRFLPNLCNVTLISEVLQQSYRLRVSASALRSVE
HRGGLDGFLVKADDKELSQRARLLKRQIVKKKAEKAA
Download sequence
Identical sequences A0A2J9TIJ4 Q6G5T1 X5M6G1
BnR19 283166.BH15920 gi|49476246|ref|YP_034287.1| WP_011181357.1.16088 WP_011181357.1.16224 WP_011181357.1.16800 WP_011181357.1.20053 WP_011181357.1.27566 WP_011181357.1.28492 WP_011181357.1.31727 WP_011181357.1.4240 WP_011181357.1.6076 WP_011181357.1.60777 WP_011181357.1.65326 WP_011181357.1.67260 WP_011181357.1.68342 WP_011181357.1.77700 WP_011181357.1.8075 WP_011181357.1.83501 WP_011181357.1.8516 WP_011181357.1.87377 WP_011181357.1.88456 WP_011181357.1.95042 WP_011181357.1.96330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]