SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000000534 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  28377.ENSACAP00000000534
Domain Number - Region: 66-93
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0863
Family Insect pheromone/odorant-binding proteins 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000000534
Sequence length 137
Comment (Anolis carolinensis)
Sequence
MRPPQPPVASKVFVQRDYSSGTKCQFQTKFPPELENRLDRQQFEETVRTLNNLYAEAEKL
GSQSYLEGCLACLTAYTIFLCMETHYEKVLKKIAKYVQEQNEKIYAPQGLLLTDPIERGL
RVIEITIYEDRSVSSGR
Download sequence
Identical sequences H9G3X9
ENSACAP00000000534 28377.ENSACAP00000000534 ENSACAP00000000534

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]