SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 28377.ENSACAP00000000782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  28377.ENSACAP00000000782
Domain Number 1 Region: 94-184
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 5.93e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0012
Further Details:      
 
Domain Number 2 Region: 276-351
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.6e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000294
Further Details:      
 
Domain Number 3 Region: 8-83
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 7.6e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 28377.ENSACAP00000000782
Sequence length 360
Comment (Anolis carolinensis)
Sequence
MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIIT
LAGPTNAIFKAFAMIIDKLEEDISSSMTNSTASSRPPVTLRLVVPASQCGSLIGKGGCKI
KEIRESTGAQVQVAGDMLPNSTERAITIAGIPQSIIECVKQICVVMLESPPKGVTIPYRP
KPSSSPVIFAGGQDRYSSGSASYPHTAPSMCLNSDLEGPPQEAYTIQGQYAIPQPDLTKL
HQLAMQQSHFPMSHGNTGFSGVESSSPDEKGYWAGLDASAQTTSHELTIPNDLIGCIIGR
QGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQYLINVRLSSETGGMGSS
Download sequence
Identical sequences XP_008101866.1.98722 XP_020640155.1.8467 28377.ENSACAP00000000782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]